![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.9: Neurophysin II [49605] (1 superfamily) sandwich; 8 strands in 2 sheets; meander |
![]() | Superfamily b.9.1: Neurophysin II [49606] (1 family) ![]() duplication: composed of two structural repeats automatically mapped to Pfam PF00184 |
![]() | Family b.9.1.1: Neurophysin II [49607] (1 protein) |
![]() | Protein Neurophysin II [49608] (1 species) can be classified as disulfide-rich |
![]() | Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries) |
![]() | Domain d2bn2e_: 2bn2 E: [23268] complexed with phe, tyr |
PDB Entry: 2bn2 (more details), 2.8 Å
SCOPe Domain Sequences for d2bn2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bn2e_ b.9.1.1 (E:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]} lrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr caaagiccndescvtepec
Timeline for d2bn2e_: