Lineage for d2bn2e_ (2bn2 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773430Fold b.9: Neurophysin II [49605] (1 superfamily)
    sandwich; 8 strands in 2 sheets; meander
  4. 2773431Superfamily b.9.1: Neurophysin II [49606] (1 family) (S)
    duplication: composed of two structural repeats
    automatically mapped to Pfam PF00184
  5. 2773432Family b.9.1.1: Neurophysin II [49607] (1 protein)
  6. 2773433Protein Neurophysin II [49608] (1 species)
    can be classified as disulfide-rich
  7. 2773434Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries)
  8. 2773442Domain d2bn2e_: 2bn2 E: [23268]
    complexed with phe, tyr

Details for d2bn2e_

PDB Entry: 2bn2 (more details), 2.8 Å

PDB Description: crystal structure of bovine neurophysin ii complexed with the vasopressin analogue phe-tyr amide
PDB Compounds: (E:) neurophysin II

SCOPe Domain Sequences for d2bn2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bn2e_ b.9.1.1 (E:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
lrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
caaagiccndescvtepec

SCOPe Domain Coordinates for d2bn2e_:

Click to download the PDB-style file with coordinates for d2bn2e_.
(The format of our PDB-style files is described here.)

Timeline for d2bn2e_: