SCOPe 2.04: Domain d3k9oa1: 3k9o A:3-156

Lineage for d3k9oa1 (3k9o A:3-156)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
   ubc1 homologue; also contains the C-terminal UBA domain

7. Species Human (Homo sapiens) [TaxId:9606] [143064] (6 PDB entries)
   Uniprot P61086 1-156

8. Domain d3k9oa1: 3k9o A:3-156 [232679]
   Other proteins in same PDB: d3k9oa2, d3k9ob_
   automated match to d1ylaa2

Details for d3k9oa1

PDB Entry: 3k9o, 1.8 Å

PDB Description: The crystal structure of E2-25K and UBB+1 complex

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d3k9oa1:

Sequence; same for both SEQRES and ATOM records:

>d3k9oa1 d.20.1.1 (A:3-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
niavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqleiki
petypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaaep
ddpqdavvanqykqnpemfkqtarlwahvyagap

Timeline for d3k9oa1:

• d3k9oa1 first appeared in SCOPe 2.03
  
• d3k9oa1 appears in SCOPe 2.05
  
• d3k9oa1 appears in the current release, SCOPe 2.08