Lineage for d3k7jb_ (3k7j B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956780Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2956781Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2956786Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 2956800Protein automated matches [190324] (2 species)
    not a true protein
  7. 2956801Species Human (Homo sapiens) [TaxId:9606] [188953] (17 PDB entries)
  8. 2956814Domain d3k7jb_: 3k7j B: [232678]
    automated match to d1vhha_
    complexed with co3, so4, zn; mutant

Details for d3k7jb_

PDB Entry: 3k7j (more details), 1.9 Å

PDB Description: Crystal structure of the D100E mutant of the Indian Hedgehog N-terminal signalling domain
PDB Compounds: (B:) Indian hedgehog protein

SCOPe Domain Sequences for d3k7jb_:

Sequence, based on SEQRES records: (download)

>d3k7jb_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prklvplaykqfspnvpektlgasgryegkiarsserfkeltpnynpdiifkdeentgae
rlmtqrckdrlnslaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdr
nkygllarlaveagfdwvyyeskahvhcsvks

Sequence, based on observed residues (ATOM records): (download)

>d3k7jb_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prklvplaykqfspnvpektlgasgryegkiarsserfkeltpnynpdiifkaerlmtqr
ckdrlnslaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrnkygll
arlaveagfdwvyyeskahvhcsvks

SCOPe Domain Coordinates for d3k7jb_:

Click to download the PDB-style file with coordinates for d3k7jb_.
(The format of our PDB-style files is described here.)

Timeline for d3k7jb_: