| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) ![]() zinc-binding motif |
| Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins) automatically mapped to Pfam PF01085 |
| Protein automated matches [190324] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188953] (17 PDB entries) |
| Domain d3k7hb_: 3k7h B: [232676] automated match to d1vhha_ complexed with so4, zn; mutant |
PDB Entry: 3k7h (more details), 1.5 Å
SCOPe Domain Sequences for d3k7hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k7hb_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prklvplaykqfspnvpektlgasgryegkiarsserfkeltpnynpdiifkdekntgad
rlmtqrckdrlnslaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdr
nkygllarlaveagfdwvyyeskahvhcsvksehsaa
Timeline for d3k7hb_: