SCOPe 2.03: Domain d3k5ka_: 3k5k A:

Lineage for d3k5ka_ (3k5k A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.0: automated matches [227191] (1 protein)
   not a true family

6. Protein automated matches [226914] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225158] (10 PDB entries)

8. Domain d3k5ka_: 3k5k A: [232670]
   automated match to d3mo5c_
   complexed with cl, dxq, sah, unx, zn

Details for d3k5ka_

PDB Entry: 3k5k, 1.7 Å

PDB Description: discovery of a 2,4-diamino-7-aminoalkoxy-quinazoline as a potent inhibitor of histone lysine methyltransferase, g9a

PDB Compounds: (A:) Histone-lysine N-methyltransferase, H3 lysine-9 specific 3

SCOPe Domain Sequences for d3k5ka_:

Sequence, based on SEQRES records:

>d3k5ka_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctc
vddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgi
kvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgev
ycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygd
rfwdikskyftcqcgsekckhsaeaialeqsrla

Sequence, based on observed residues (ATOM records):

>d3k5ka_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctc
vddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgi
kvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkevyc
idaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrf
wdikskyftcqcgsekckhsaeaialeqsrla

Timeline for d3k5ka_:

• d3k5ka_ is new in SCOPe 2.03-stable
  
• d3k5ka_ appears in SCOPe 2.04
  
• d3k5ka_ appears in the current release, SCOPe 2.08