SCOPe 2.05: Domain d2bn2c_: 2bn2 C:

Lineage for d2bn2c_ (2bn2 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.9: Neurophysin II [49605] (1 superfamily)
   sandwich; 8 strands in 2 sheets; meander

4. Superfamily b.9.1: Neurophysin II [49606] (1 family)
   duplication: composed of two structural repeats
   automatically mapped to Pfam PF00184

5. Family b.9.1.1: Neurophysin II [49607] (1 protein)

6. Protein Neurophysin II [49608] (1 species)
   can be classified as disulfide-rich

7. Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries)

8. Domain d2bn2c_: 2bn2 C: [23267]
   complexed with phe, tyr

Details for d2bn2c_

PDB Entry: 2bn2, 2.8 Å

PDB Description: crystal structure of bovine neurophysin ii complexed with the vasopressin analogue phe-tyr amide

PDB Compounds: (C:) neurophysin II

SCOPe Domain Sequences for d2bn2c_:

Sequence; same for both SEQRES and ATOM records:

>d2bn2c_ b.9.1.1 (C:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
lrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
caaagiccndescvtepec

Timeline for d2bn2c_:

• d2bn2c_ first appeared (with stable ids) in SCOP 1.55
  
• d2bn2c_ appears in SCOPe 2.04
  
• d2bn2c_ appears in SCOPe 2.06
  
• d2bn2c_ appears in the current release, SCOPe 2.08