| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
| Protein automated matches [190976] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries) |
| Domain d3k2md_: 3k2m D: [232663] Other proteins in same PDB: d3k2ma_, d3k2mb_ automated match to d2ck2a_ complexed with po4 |
PDB Entry: 3k2m (more details), 1.75 Å
SCOPe Domain Sequences for d3k2md_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k2md_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssvssvptklevvaatptslliswdapmssssvyyyritygetggnspvqeftvpysss
tatisglspgvdytitvyawgedsagymfmyspisinyrtc
Timeline for d3k2md_: