Lineage for d2bn2a_ (2bn2 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11435Fold b.9: Neurophysin II [49605] (1 superfamily)
  4. 11436Superfamily b.9.1: Neurophysin II [49606] (1 family) (S)
  5. 11437Family b.9.1.1: Neurophysin II [49607] (1 protein)
  6. 11438Protein Neurophysin II [49608] (1 species)
  7. 11439Species Cow (Bos taurus) [TaxId:9913] [49609] (2 PDB entries)
  8. 11440Domain d2bn2a_: 2bn2 A: [23266]

Details for d2bn2a_

PDB Entry: 2bn2 (more details), 2.8 Å

PDB Description: crystal structure of bovine neurophysin ii complexed with the vasopressin analogue phe-tyr amide

SCOP Domain Sequences for d2bn2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bn2a_ b.9.1.1 (A:) Neurophysin II {Cow (Bos taurus)}
amsdlelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
cgsggrcaaagiccndescvtepec

SCOP Domain Coordinates for d2bn2a_:

Click to download the PDB-style file with coordinates for d2bn2a_.
(The format of our PDB-style files is described here.)

Timeline for d2bn2a_: