SCOPe 2.03: Domain d3jwnn2: 3jwn N:159-279

Lineage for d3jwnn2 (3jwn N:159-279)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.3: Bacterial adhesins [49401] (7 families)
Family b.2.3.2: Pilus subunits [49405] (9 proteins)
Protein automated matches [190569] (7 species)
not a true protein
Species Escherichia coli [TaxId:488477] [232652] (1 PDB entry)
Domain d3jwnn2: 3jwn N:159-279 [232656]
Other proteins in same PDB: d3jwnc1, d3jwnc2, d3jwni1, d3jwni2
automated match to d1ze3h1
complexed with gol

Details for d3jwnn2

PDB Entry: 3jwn (more details), 2.69 Å

PDB Description: Complex of FimC, FimF, FimG and FimH

PDB Compounds: (N:) FimH PROTEIN

SCOPe Domain Sequences for d3jwnn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwnn2 b.2.3.2 (N:159-279) automated matches {Escherichia coli [TaxId: 488477]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOPe Domain Coordinates for d3jwnn2:

Click to download the PDB-style file with coordinates for d3jwnn2.
(The format of our PDB-style files is described here.)

Timeline for d3jwnn2: