Lineage for d3jwnh2 (3jwn H:159-279)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771869Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1771874Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1772012Protein automated matches [190569] (8 species)
    not a true protein
  7. 1772015Species Escherichia coli [TaxId:488477] [232652] (1 PDB entry)
  8. 1772017Domain d3jwnh2: 3jwn H:159-279 [232654]
    Other proteins in same PDB: d3jwnc1, d3jwnc2, d3jwni1, d3jwni2
    automated match to d1ze3h1
    complexed with gol

Details for d3jwnh2

PDB Entry: 3jwn (more details), 2.69 Å

PDB Description: Complex of FimC, FimF, FimG and FimH
PDB Compounds: (H:) FimH PROTEIN

SCOPe Domain Sequences for d3jwnh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwnh2 b.2.3.2 (H:159-279) automated matches {Escherichia coli [TaxId: 488477]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOPe Domain Coordinates for d3jwnh2:

Click to download the PDB-style file with coordinates for d3jwnh2.
(The format of our PDB-style files is described here.)

Timeline for d3jwnh2: