SCOPe 2.04: Domain d3jwnh2: 3jwn H:159-279

Lineage for d3jwnh2 (3jwn H:159-279)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein automated matches [190569] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:488477] [232652] (1 PDB entry)

8. Domain d3jwnh2: 3jwn H:159-279 [232654]
   Other proteins in same PDB: d3jwnc1, d3jwnc2, d3jwni1, d3jwni2
   automated match to d1ze3h1
   complexed with gol

Details for d3jwnh2

PDB Entry: 3jwn, 2.69 Å

PDB Description: Complex of FimC, FimF, FimG and FimH

PDB Compounds: (H:) FimH PROTEIN

SCOPe Domain Sequences for d3jwnh2:

Sequence; same for both SEQRES and ATOM records:

>d3jwnh2 b.2.3.2 (H:159-279) automated matches {Escherichia coli [TaxId: 488477]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

Timeline for d3jwnh2:

• d3jwnh2 first appeared in SCOPe 2.03
  
• d3jwnh2 appears in SCOPe 2.05
  
• d3jwnh2 appears in the current release, SCOPe 2.08