Lineage for d3jwnh1 (3jwn H:1-158)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377244Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2377427Protein automated matches [190569] (9 species)
    not a true protein
  7. 2377435Species Escherichia coli [TaxId:488477] [232652] (2 PDB entries)
  8. 2377436Domain d3jwnh1: 3jwn H:1-158 [232653]
    Other proteins in same PDB: d3jwnc1, d3jwnc2, d3jwne_, d3jwnf_, d3jwni1, d3jwni2
    automated match to d4av5a_
    complexed with gol

Details for d3jwnh1

PDB Entry: 3jwn (more details), 2.69 Å

PDB Description: Complex of FimC, FimF, FimG and FimH
PDB Compounds: (H:) FimH PROTEIN

SCOPe Domain Sequences for d3jwnh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwnh1 b.2.3.2 (H:1-158) automated matches {Escherichia coli [TaxId: 488477]}
facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d3jwnh1:

Click to download the PDB-style file with coordinates for d3jwnh1.
(The format of our PDB-style files is described here.)

Timeline for d3jwnh1: