![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (10 proteins) |
![]() | Protein automated matches [190569] (10 species) not a true protein |
![]() | Species Escherichia coli [TaxId:488477] [232652] (1 PDB entry) |
![]() | Domain d3jwnh1: 3jwn H:1-158 [232653] Other proteins in same PDB: d3jwnc1, d3jwnc2, d3jwni1, d3jwni2 automated match to d4av5a_ complexed with gol |
PDB Entry: 3jwn (more details), 2.69 Å
SCOPe Domain Sequences for d3jwnh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jwnh1 b.2.3.2 (H:1-158) automated matches {Escherichia coli [TaxId: 488477]} facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d3jwnh1: