SCOPe 2.07: Domain d3jwdd2: 3jwd D:1098-1183

Lineage for d3jwdd2 (3jwd D:1098-1183)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 protein domains)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries)

8. Domain d3jwdd2: 3jwd D:1098-1183 [232651]
   Other proteins in same PDB: d3jwdc1, d3jwdd1, d3jwdl1, d3jwdl2, d3jwdo1, d3jwdo2
   automated match to d2nxyb2
   complexed with gol, nag

Details for d3jwdd2

PDB Entry: 3jwd, 2.61 Å

PDB Description: Structure of HIV-1 gp120 with gp41-Interactive Region: Layered Architecture and Basis of Conformational Mobility

PDB Compounds: (D:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d3jwdd2:

Sequence; same for both SEQRES and ATOM records:

>d3jwdd2 b.1.1.3 (D:1098-1183) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqkas

Timeline for d3jwdd2:

• d3jwdd2 first appeared in SCOPe 2.03
  
• d3jwdd2 appears in SCOPe 2.06