SCOPe 2.08: Domain d3jwdd2: 3jwd D:1098-1183

Lineage for d3jwdd2 (3jwd D:1098-1183)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.3: C2 set domains [49142] (8 proteins)
Protein CD4 C2-set domains [49149] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)
Domain d3jwdd2: 3jwd D:1098-1183 [232651]
Other proteins in same PDB: d3jwdc1, d3jwdc3, d3jwdd1, d3jwdl1, d3jwdl2, d3jwdo1, d3jwdo2
automated match to d2nxyb2
complexed with gol, nag

Details for d3jwdd2

PDB Entry: 3jwd (more details), 2.61 Å

PDB Description: structure of hiv-1 gp120 with gp41-interactive region: layered architecture and basis of conformational mobility

PDB Compounds: (D:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d3jwdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwdd2 b.1.1.3 (D:1098-1183) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqkas

SCOPe Domain Coordinates for d3jwdd2:

Click to download the PDB-style file with coordinates for d3jwdd2.
(The format of our PDB-style files is described here.)

Timeline for d3jwdd2: