![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries) |
![]() | Domain d3jwdd2: 3jwd D:1098-1183 [232651] Other proteins in same PDB: d3jwdc1, d3jwdc3, d3jwdd1, d3jwdl1, d3jwdl2, d3jwdo1, d3jwdo2 automated match to d2nxyb2 complexed with gol, nag |
PDB Entry: 3jwd (more details), 2.61 Å
SCOPe Domain Sequences for d3jwdd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jwdd2 b.1.1.3 (D:1098-1183) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvlafqkas
Timeline for d3jwdd2: