| Class b: All beta proteins [48724] (180 folds) |
| Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
| Family b.8.1.1: MATH domain [49600] (5 proteins) automatically mapped to Pfam PF00917 |
| Protein TNF receptor associated factor 3 (TRAF3) [49603] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49604] (5 PDB entries) Uniprot Q13114 377-568 |
| Domain d1fllb1: 1fll B:350-504 [23265] Other proteins in same PDB: d1flla2, d1fllb2 |
PDB Entry: 1fll (more details), 3.5 Å
SCOPe Domain Sequences for d1fllb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fllb1 b.8.1.1 (B:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]}
yngvliwkirdykrrkqeavmgktlslysqpfytgyfgykmcarvylngdgmgkgthlsl
ffvimrgeydallpwpfkqkvtlmlmdqgssrrhlgdafkpdpnsssfkkptgemniasg
cpvfvaqtvlengtyikddtifikvivdtsdlpdp
Timeline for d1fllb1: