SCOPe 2.08: Domain d3jwdd1: 3jwd D:1001-1097

Lineage for d3jwdd1 (3jwd D:1001-1097)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein CD4 V-set domains [48737] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [48738] (33 PDB entries)
Domain d3jwdd1: 3jwd D:1001-1097 [232649]
Other proteins in same PDB: d3jwdc2, d3jwdc3, d3jwdd2, d3jwdl1, d3jwdl2, d3jwdo1, d3jwdo2
automated match to d2nxyb1
complexed with gol, nag

Details for d3jwdd1

PDB Entry: 3jwd (more details), 2.61 Å

PDB Description: structure of hiv-1 gp120 with gp41-interactive region: layered architecture and basis of conformational mobility

PDB Compounds: (D:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d3jwdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwdd1 b.1.1.1 (D:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d3jwdd1:

Click to download the PDB-style file with coordinates for d3jwdd1.
(The format of our PDB-style files is described here.)

Timeline for d3jwdd1: