Lineage for d3jv6e_ (3jv6 E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1299387Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 1299492Protein automated matches [226855] (1 species)
    not a true protein
  7. 1299493Species Mouse (Mus musculus) [TaxId:10090] [224977] (7 PDB entries)
  8. 1299504Domain d3jv6e_: 3jv6 E: [232646]
    automated match to d1zk9a_
    complexed with so4

Details for d3jv6e_

PDB Entry: 3jv6 (more details), 2.78 Å

PDB Description: Crystal structure of the dimerization domains p52 and RelB
PDB Compounds: (E:) transcription factor relb

SCOPe Domain Sequences for d3jv6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jv6e_ b.1.18.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiai
vfktppyedleisepvtvnvflqrltdgvcseplpftylpr

SCOPe Domain Coordinates for d3jv6e_:

Click to download the PDB-style file with coordinates for d3jv6e_.
(The format of our PDB-style files is described here.)

Timeline for d3jv6e_: