| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
| Protein automated matches [226855] (1 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224977] (9 PDB entries) |
| Domain d3jv6c_: 3jv6 C: [232644] automated match to d1zk9a_ complexed with so4 |
PDB Entry: 3jv6 (more details), 2.78 Å
SCOPe Domain Sequences for d3jv6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jv6c_ b.1.18.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiai
vfktppyedleisepvtvnvflqrltdgvcseplpftylpr
Timeline for d3jv6c_: