Lineage for d3ju8b_ (3ju8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141444Species Pseudomonas aeruginosa [TaxId:287] [225751] (7 PDB entries)
  8. 2141446Domain d3ju8b_: 3ju8 B: [232641]
    Other proteins in same PDB: d3ju8a2
    automated match to d3jz4d_
    complexed with cl, gol, mg, nad, sin, so4

Details for d3ju8b_

PDB Entry: 3ju8 (more details), 1.82 Å

PDB Description: Crystal Structure of Succinylglutamic Semialdehyde Dehydrogenase from Pseudomonas aeruginosa.
PDB Compounds: (B:) Succinylglutamic semialdehyde dehydrogenase

SCOPe Domain Sequences for d3ju8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ju8b_ c.82.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
msthyiagqwlagqgetlesldpvgqgvvwsgrgadatqvdaavcaareafpawarrple
qriellerfaatlksradelarvigeetgkplwesatevtsmvnkvaisvqafrertgek
sgpladatavlrhkphgvvavfgpynfpghlpnghivpallagncvvfkpseltpkvael
tlkawiqaglpagvlnlvqggretgvalaahrgldglfftgssrtgnllhsqfggqpqki
lalemggnnplvveevadldaavytiiqsafisagqrctcarrllvpqgawgdallarlv
avsatlrvgrfdeqpapfmgavislsaaehllkaqehligkgaqpllamtqpidgaallt
pgildvsavaerpdeeffgpllqvirysdfaaaireanatqyglaagllsdsrerfeqfl
vesragivnwnkqltgaassapfggigasgnhrpsayyaadycaypvaslespsvslpat
ltpgi

SCOPe Domain Coordinates for d3ju8b_:

Click to download the PDB-style file with coordinates for d3ju8b_.
(The format of our PDB-style files is described here.)

Timeline for d3ju8b_: