SCOPe 2.08: Domain d3iv2a_: 3iv2 A:

Lineage for d3iv2a_ (3iv2 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries)

8. Domain d3iv2a_: 3iv2 A: [232636]
   automated match to d2xu4a_
   complexed with gol, na, nag, so4; mutant

Details for d3iv2a_

PDB Entry: 3iv2, 2.2 Å

PDB Description: crystal structure of mature apo-cathepsin l c25a mutant

PDB Compounds: (A:) Cathepsin L1

SCOPe Domain Sequences for d3iv2a_:

Sequence; same for both SEQRES and ATOM records:

>d3iv2a_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prsvdwrekgyvtpvknqgqcgsawafsatgalegqmfrktgrlislseqnlvdcsgpqg
negcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqeka
lmkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnnk
ywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Timeline for d3iv2a_:

• d3iv2a_ first appeared in SCOPe 2.03
  
• d3iv2a_ appears in SCOPe 2.07