Lineage for d3iula2 (3iul A:418-688)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136081Species Aeromonas punctata [TaxId:648] [232631] (8 PDB entries)
  8. 2136084Domain d3iula2: 3iul A:418-688 [232632]
    Other proteins in same PDB: d3iula1
    automated match to d2bkla2
    complexed with gol

Details for d3iula2

PDB Entry: 3iul (more details), 1.95 Å

PDB Description: appep_wt1 opened state
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d3iula2:

Sequence, based on SEQRES records: (download)

>d3iula2 c.69.1.0 (A:418-688) automated matches {Aeromonas punctata [TaxId: 648]}
edyvseqrfyqskdgtrvpliisyrkglkldgsnptilygyggfdvsltpsfsvsvanwl
dlggvyavanlrgggeygqawhlagtqqnkqnvfddfiaaaeylkaegytrtdrlairgg
snggllvgavmtqrpdlmrvalpavgvldmlryhtftagtgwaydygtsadseamfdylk
gysplhnvrpgvsypstmvttadhddrvvpahsfkfaatlqadnagphpqlirietnagh
gagtpvaklieqsadiyaftlyemgyrelpr

Sequence, based on observed residues (ATOM records): (download)

>d3iula2 c.69.1.0 (A:418-688) automated matches {Aeromonas punctata [TaxId: 648]}
edyvseqrfyqskdgtrvpliisyrkglkldgsnptilygyggfdvsltpsfsvsvanwl
dlggvyavanlrgggeygqawhlagtqqnkqnvfddfiaaaeylkaegytrtdrlairgg
snggllvgavmtqrpdlmrvalpavgvldmlryhtftagtgwaydygtsadseamfdylk
gysplhnvrpgvsypstmvttadhddrvvpahsfkfaatlqadnagphpqlirietpvak
lieqsadiyaftlyemgyrelpr

SCOPe Domain Coordinates for d3iula2:

Click to download the PDB-style file with coordinates for d3iula2.
(The format of our PDB-style files is described here.)

Timeline for d3iula2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3iula1