Lineage for d3iugb_ (3iug B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006251Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2006252Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2006284Family a.116.1.0: automated matches [227202] (1 protein)
    not a true family
  6. 2006285Protein automated matches [226932] (3 species)
    not a true protein
  7. 2006288Species Human (Homo sapiens) [TaxId:9606] [225230] (9 PDB entries)
  8. 2006291Domain d3iugb_: 3iug B: [232628]
    Other proteins in same PDB: d3iuga2
    automated match to d2osaa_
    complexed with unx

Details for d3iugb_

PDB Entry: 3iug (more details), 1.77 Å

PDB Description: crystal structure of the rhogap domain of rics
PDB Compounds: (B:) Rho/Cdc42/Rac GTPase-activating protein RICS

SCOPe Domain Sequences for d3iugb_:

Sequence, based on SEQRES records: (download)

>d3iugb_ a.116.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvfgcdlgehllnsgfevpqvlqsctafierygivdgiyrlsgvasniqrlrhefdsehv
pdltkepyvqdihsvgslcklyfrelpnplltyqlyekfsdavsaatdeerlikihdviq
qlppphyrtleflmrhlslladycsitnmhaknlaivwapnllrskqiesacfsgtaafm
evriqsvvvefilnhvdvlfsg

Sequence, based on observed residues (ATOM records): (download)

>d3iugb_ a.116.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvfgcdlgehllnsgfevpqvlqsctafierygivdgiyrlsgvasniqrlrhefdsehv
pdltkepyvqdihsvgslcklyfrelpnplltyqlyekfsdavsaatdeerlikihdviq
qlppphyrtleflmrhlslladycsitnmhaknlaivwapnllrsvriqsvvvefilnhv
dvlfsg

SCOPe Domain Coordinates for d3iugb_:

Click to download the PDB-style file with coordinates for d3iugb_.
(The format of our PDB-style files is described here.)

Timeline for d3iugb_: