![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
![]() | Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
![]() | Family a.116.1.0: automated matches [227202] (1 protein) not a true family |
![]() | Protein automated matches [226932] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225230] (14 PDB entries) |
![]() | Domain d3iugb_: 3iug B: [232628] Other proteins in same PDB: d3iuga2 automated match to d2osaa_ complexed with unx |
PDB Entry: 3iug (more details), 1.77 Å
SCOPe Domain Sequences for d3iugb_:
Sequence, based on SEQRES records: (download)
>d3iugb_ a.116.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rvfgcdlgehllnsgfevpqvlqsctafierygivdgiyrlsgvasniqrlrhefdsehv pdltkepyvqdihsvgslcklyfrelpnplltyqlyekfsdavsaatdeerlikihdviq qlppphyrtleflmrhlslladycsitnmhaknlaivwapnllrskqiesacfsgtaafm evriqsvvvefilnhvdvlfsg
>d3iugb_ a.116.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rvfgcdlgehllnsgfevpqvlqsctafierygivdgiyrlsgvasniqrlrhefdsehv pdltkepyvqdihsvgslcklyfrelpnplltyqlyekfsdavsaatdeerlikihdviq qlppphyrtleflmrhlslladycsitnmhaknlaivwapnllrsvriqsvvvefilnhv dvlfsg
Timeline for d3iugb_: