SCOPe 2.08: Domain d3iu5a1: 3iu5 A:43-154

Lineage for d3iu5a1 (3iu5 A:43-154)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d3iu5a1: 3iu5 A:43-154 [232626]
   Other proteins in same PDB: d3iu5a2
   automated match to d3hmfa_

Details for d3iu5a1

PDB Entry: 3iu5, 1.63 Å

PDB Description: Crystal structure of the first bromodomain of human poly-bromodomain containing protein 1 (PB1)

PDB Compounds: (A:) Protein polybromo-1

SCOPe Domain Sequences for d3iu5a1:

Sequence; same for both SEQRES and ATOM records:

>d3iu5a1 a.29.2.0 (A:43-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvdpiavchelyntirdykdeqgrllcelfirapkrrnqpdyyevvsqpidlmkiqqklk
meeyddvnlltadfqllfnnaksyykpdspeykaacklwdlylrtrnefvqk

Timeline for d3iu5a1:

• d3iu5a1 first appeared in SCOPe 2.03, called d3iu5a_
  
• d3iu5a1 appears in SCOPe 2.07