Lineage for d3it9b1 (3it9 B:8-258)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (45 species)
    not a true protein
  7. 2569813Species Escherichia coli [TaxId:562] [225496] (15 PDB entries)
  8. 2569835Domain d3it9b1: 3it9 B:8-258 [232622]
    Other proteins in same PDB: d3it9a2, d3it9b2, d3it9c2, d3it9d2
    automated match to d1nj4a2
    complexed with so4, suc

Details for d3it9b1

PDB Entry: 3it9 (more details), 2.1 Å

PDB Description: crystal structure of penicillin-binding protein 6 (pbp6) from e. coli in apo state
PDB Compounds: (B:) D-alanyl-D-alanine carboxypeptidase dacC

SCOPe Domain Sequences for d3it9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3it9b1 e.3.1.0 (B:8-258) automated matches {Escherichia coli [TaxId: 562]}
apsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkikltdmvtv
gkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvagsqesfig
lmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihkekeftfn
kirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgaktdrirfne
seklltwgfrf

SCOPe Domain Coordinates for d3it9b1:

Click to download the PDB-style file with coordinates for d3it9b1.
(The format of our PDB-style files is described here.)

Timeline for d3it9b1: