| Class b: All beta proteins [48724] (176 folds) |
| Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
| Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
| Protein automated matches [191195] (6 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [232115] (4 PDB entries) |
| Domain d3ir7a2: 3ir7 A:1075-1244 [232618] Other proteins in same PDB: d3ir7a1, d3ir7b_, d3ir7c_ automated match to d1q16a1 complexed with 6mo, aga, f3s, hem, md1, sf4; mutant |
PDB Entry: 3ir7 (more details), 2.5 Å
SCOPe Domain Sequences for d3ir7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ir7a2 b.52.2.0 (A:1075-1244) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes
Timeline for d3ir7a2: