Lineage for d3ir7a1 (3ir7 A:1-1074)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140649Protein automated matches [227025] (4 species)
    not a true protein
  7. 2140654Species Escherichia coli K-12 [TaxId:83333] [232054] (4 PDB entries)
  8. 2140657Domain d3ir7a1: 3ir7 A:1-1074 [232617]
    Other proteins in same PDB: d3ir7a2, d3ir7b_, d3ir7c_
    automated match to d1q16a2
    complexed with 6mo, aga, f3s, hem, md1, sf4; mutant

Details for d3ir7a1

PDB Entry: 3ir7 (more details), 2.5 Å

PDB Description: crystal structure of narghi mutant narg-r94s
PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chain

SCOPe Domain Sequences for d3ir7a1:

Sequence, based on SEQRES records: (download)

>d3ir7a1 c.81.1.1 (A:1-1074) automated matches {Escherichia coli K-12 [TaxId: 83333]}
skfldrfryfkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscswk
iyvknglvtwetqqtdyprtrpdlpnheprgcpsgasyswylysanrlkypmmrkrlmkm
wreakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytikny
gpdrvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpes
adwynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqg
tdaamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadl
vdalgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsll
gsqdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlan
yglerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiiv
gaglnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqr
parhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapq
lgtnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgss
gkghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstcl
ysdiilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvgh
lgketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerft
sigplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlap
etngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehv
synagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevi

Sequence, based on observed residues (ATOM records): (download)

>d3ir7a1 c.81.1.1 (A:1-1074) automated matches {Escherichia coli K-12 [TaxId: 83333]}
skfldrffkqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscswkiy
vknglvtwetqqtdyprtrpdlpnheprgcpsgasyswylysanrlkypmmrkrlmkmwr
eakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytiknygp
drvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpesad
wynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqgtd
aamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadlvd
algqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsllgs
qdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlanyg
lerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiivga
glnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqrpa
rhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapqlg
tnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgssgk
ghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstclys
diilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvghlg
ketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerftsi
gplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlapet
ngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehvsy
nagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevi

SCOPe Domain Coordinates for d3ir7a1:

Click to download the PDB-style file with coordinates for d3ir7a1.
(The format of our PDB-style files is described here.)

Timeline for d3ir7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ir7a2