Lineage for d3ir6a2 (3ir6 A:1075-1244)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550393Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1550447Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1550627Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 1550628Protein automated matches [191195] (6 species)
    not a true protein
  7. 1550633Species Escherichia coli K-12 [TaxId:83333] [232115] (4 PDB entries)
  8. 1550637Domain d3ir6a2: 3ir6 A:1075-1244 [232616]
    Other proteins in same PDB: d3ir6a1, d3ir6b_, d3ir6c_
    automated match to d1q16a1
    complexed with aga, f3s, gdp, hem, sf4; mutant

Details for d3ir6a2

PDB Entry: 3ir6 (more details), 2.8 Å

PDB Description: crystal structure of narghi mutant narg-h49s
PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chain

SCOPe Domain Sequences for d3ir6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ir6a2 b.52.2.0 (A:1075-1244) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes

SCOPe Domain Coordinates for d3ir6a2:

Click to download the PDB-style file with coordinates for d3ir6a2.
(The format of our PDB-style files is described here.)

Timeline for d3ir6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ir6a1