Lineage for d3ir5a2 (3ir5 A:1075-1244)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323003Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1323057Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1323239Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 1323240Protein automated matches [191195] (3 species)
    not a true protein
  7. 1323241Species Escherichia coli [TaxId:83333] [232115] (4 PDB entries)
  8. 1323243Domain d3ir5a2: 3ir5 A:1075-1244 [232614]
    Other proteins in same PDB: d3ir5a1, d3ir5b_, d3ir5c_
    automated match to d1q16a1
    complexed with 6mo, aga, f3s, hem, md1, sf4; mutant

Details for d3ir5a2

PDB Entry: 3ir5 (more details), 2.3 Å

PDB Description: crystal structure of narghi mutant narg-h49c
PDB Compounds: (A:) Respiratory nitrate reductase 1 alpha chain

SCOPe Domain Sequences for d3ir5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ir5a2 b.52.2.0 (A:1075-1244) automated matches {Escherichia coli [TaxId: 83333]}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes

SCOPe Domain Coordinates for d3ir5a2:

Click to download the PDB-style file with coordinates for d3ir5a2.
(The format of our PDB-style files is described here.)

Timeline for d3ir5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ir5a1