SCOPe 2.03: Domain d3ir1b_: 3ir1 B:

Lineage for d3ir1b_ (3ir1 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (57 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:487] [232610] (1 PDB entry)

8. Domain d3ir1b_: 3ir1 B: [232612]
   automated match to d4gota_
   complexed with met, so4

Details for d3ir1b_

PDB Entry: 3ir1, 2.15 Å

PDB Description: Crystal Structure of Lipoprotein GNA1946 from Neisseria meningitidis

PDB Compounds: (B:) Outer membrane lipoprotein GNA1946

SCOPe Domain Sequences for d3ir1b_:

Sequence; same for both SEQRES and ATOM records:

>d3ir1b_ c.94.1.0 (B:) automated matches {Neisseria meningitidis [TaxId: 487]}
keivfgttvgdfgdmvkeqiqpelekkgytvklveftdyvrpnlalaegeldinvfqhkp
ylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmld
elgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgm
kltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaawn
egaa

Timeline for d3ir1b_:

• d3ir1b_ is new in SCOPe 2.03-stable
  
• d3ir1b_ appears in SCOPe 2.04
  
• d3ir1b_ appears in the current release, SCOPe 2.08