Lineage for d1czzc1 (1czz C:350-501)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11382Fold b.8: TRAF domain [49598] (1 superfamily)
  4. 11383Superfamily b.8.1: TRAF domain [49599] (1 family) (S)
  5. 11384Family b.8.1.1: TRAF domain [49600] (2 proteins)
  6. 11385Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 11386Species Human (Homo sapiens) [TaxId:9606] [49602] (9 PDB entries)
  8. 11428Domain d1czzc1: 1czz C:350-501 [23261]
    Other proteins in same PDB: d1czza2, d1czzb2, d1czzc2

Details for d1czzc1

PDB Entry: 1czz (more details), 2.7 Å

PDB Description: structure of tnf receptor associated factor 2 in complex with a 17- residue cd40 peptide

SCOP Domain Sequences for d1czzc1:

Sequence, based on SEQRES records: (download)

>d1czzc1 b.8.1.1 (C:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens)}
ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

Sequence, based on observed residues (ATOM records): (download)

>d1czzc1 b.8.1.1 (C:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens)}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgagthlsl
ffvvmkgpndallawpfnqkvtlmlldqnnaahvidafrpdvtsssfqrpvddmniasgc
plfcpvskmaaansyvrddaifikaivdltgl

SCOP Domain Coordinates for d1czzc1:

Click to download the PDB-style file with coordinates for d1czzc1.
(The format of our PDB-style files is described here.)

Timeline for d1czzc1: