Lineage for d3il3a_ (3il3 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392829Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1392830Protein automated matches [196909] (40 species)
    not a true protein
  7. 1392968Species Haemophilus influenzae [TaxId:727] [232599] (1 PDB entry)
  8. 1392969Domain d3il3a_: 3il3 A: [232600]
    automated match to d4nhdb_

Details for d3il3a_

PDB Entry: 3il3 (more details), 2.7 Å

PDB Description: Structure of Haemophilus influenzae FabH
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d3il3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3il3a_ c.95.1.0 (A:) automated matches {Haemophilus influenzae [TaxId: 727]}
mnsrilstgsylpshirtnadlekmvdtsdewivtrsgirerriaaedetvatmgfeaak
naieaaqinpqdieliivattshshaypsaacqvqgllniddaisfdlaaactgfvyals
vadqfiragkvkkalvigsdlnsrkldetdrstvvlfgdgagavileaseqegiisthlh
asadknnalvlaqpergieksgyiemqgnetfklavrelsnvveetllannldkkdldwl
vphqanlriitatakklemdmsqvvvtldkyannsaatvpvaldeairdgriqrgqllll
eafgggwtwgsalvrf

SCOPe Domain Coordinates for d3il3a_:

Click to download the PDB-style file with coordinates for d3il3a_.
(The format of our PDB-style files is described here.)

Timeline for d3il3a_:

  • d3il3a_ is new in SCOPe 2.03-stable
  • d3il3a_ does not appear in SCOPe 2.04