SCOPe 2.04: Domain d3ij5d_: 3ij5 D:

Lineage for d3ij5d_ (3ij5 D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (45 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [232594] (1 PDB entry)

8. Domain d3ij5d_: 3ij5 D: [232598]
   automated match to d2r8xh_
   complexed with cl

Details for d3ij5d_

PDB Entry: 3ij5, 1.95 Å

PDB Description: 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno- octulosonate 8-phosphate phosphatase from yersinia pestis

PDB Compounds: (D:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d3ij5d_:

Sequence; same for both SEQRES and ATOM records:

>d3ij5d_ c.108.1.0 (D:) automated matches {Yersinia pestis [TaxId: 214092]}
sntayidtcygpvaddviqraanirllicdvdgvmsdgliymgnqgeelkafnvrdgygi
rclitsdidvaiitgrraklledrantlgithlyqgqsdklvayhellatlqcqpeqvay
igddlidwpvmaqvglsvavadahplllpkahyvtrikggrgavrevcdlillaqdkleg
atg

Timeline for d3ij5d_:

• d3ij5d_ first appeared in SCOPe 2.03
  
• d3ij5d_ appears in SCOPe 2.05
  
• d3ij5d_ appears in the current release, SCOPe 2.08