Lineage for d3ij5c_ (3ij5 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920694Species Yersinia pestis [TaxId:214092] [232594] (1 PDB entry)
  8. 2920697Domain d3ij5c_: 3ij5 C: [232597]
    automated match to d2r8xh_
    complexed with cl

Details for d3ij5c_

PDB Entry: 3ij5 (more details), 1.95 Å

PDB Description: 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno- octulosonate 8-phosphate phosphatase from yersinia pestis
PDB Compounds: (C:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d3ij5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ij5c_ c.108.1.0 (C:) automated matches {Yersinia pestis [TaxId: 214092]}
tayidtcygpvaddviqraanirllicdvdgvmsdgliymgnqgeelkafnvrdgygirc
litsdidvaiitgrraklledrantlgithlyqgqsdklvayhellatlqcqpeqvayig
ddlidwpvmaqvglsvavadahplllpkahyvtrikggrgavrevcdlillaqdklega

SCOPe Domain Coordinates for d3ij5c_:

Click to download the PDB-style file with coordinates for d3ij5c_.
(The format of our PDB-style files is described here.)

Timeline for d3ij5c_: