Lineage for d3ii7a_ (3ii7 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326286Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1326961Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 1326986Family b.68.11.0: automated matches [191536] (1 protein)
    not a true family
  6. 1326987Protein automated matches [190912] (1 species)
    not a true protein
  7. 1326988Species Human (Homo sapiens) [TaxId:9606] [188385] (4 PDB entries)
  8. 1326989Domain d3ii7a_: 3ii7 A: [232593]
    automated match to d2xn4a_
    complexed with edo

Details for d3ii7a_

PDB Entry: 3ii7 (more details), 1.63 Å

PDB Description: Crystal structure of the kelch domain of human KLHL7
PDB Compounds: (A:) Kelch-like protein 7

SCOPe Domain Sequences for d3ii7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ii7a_ b.68.11.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khdyrialfggsqpqscryfnpkdyswtdircpfekrrdaacvfwdnvvyilggsqlfpi
krmdcynvvkdswysklgpptprdslaacaaegkiytsggsevgnsalylfecydtrtes
whtkpsmltqrcshgmveangliyvcggslgnnvsgrvlnscevydpatetwtelcpmie
arknhglvfvkdkifavggqnglggldnveyydiklnewkmvspmpwkgvtvkcaavgsi
vyvlagfqgvgrlghileyntetdkwvanskvrafpvtsclicvvdtc

SCOPe Domain Coordinates for d3ii7a_:

Click to download the PDB-style file with coordinates for d3ii7a_.
(The format of our PDB-style files is described here.)

Timeline for d3ii7a_: