SCOPe 2.03: Domain d3idob_: 3ido B:

Lineage for d3idob_ (3ido B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (9 species)
   not a true protein

7. Species Entamoeba histolytica [TaxId:294381] [196531] (4 PDB entries)

8. Domain d3idob_: 3ido B: [232588]
   automated match to d3jvia_
   complexed with epe

Details for d3idob_

PDB Entry: 3ido, 2.2 Å

PDB Description: crystal structure of protein tyrosine phosphatase from entamoeba histolytica with a phosphotyrosine crude mimic hepes molecule in the active site

PDB Compounds: (B:) protein tyrosine phosphatase

SCOPe Domain Sequences for d3idob_:

Sequence; same for both SEQRES and ATOM records:

>d3idob_ c.44.1.0 (B:) automated matches {Entamoeba histolytica [TaxId: 294381]}
smkllfvclgnicrspaaeavmkkviqnhhltekyicdsagtcsyhegqqadsrmrkvgk
srgyqvdsisrpvvssdfknfdyifamdndnyyelldrcpeqykqkifkmvdfcttiktt
evpdpyyggekgfhrvidiledacenliikleegklin

Timeline for d3idob_:

• d3idob_ is new in SCOPe 2.03-stable
  
• d3idob_ appears in SCOPe 2.04
  
• d3idob_ appears in the current release, SCOPe 2.08, called d3idob1