SCOPe 2.08: Domain d3idoa1: 3ido A:1-157

Lineage for d3idoa1 (3ido A:1-157)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (20 species)
   not a true protein

7. Species Entamoeba histolytica [TaxId:294381] [196531] (4 PDB entries)

8. Domain d3idoa1: 3ido A:1-157 [232587]
   Other proteins in same PDB: d3idoa2, d3idob2
   automated match to d3jvia_
   complexed with epe

Details for d3idoa1

PDB Entry: 3ido, 2.2 Å

PDB Description: crystal structure of protein tyrosine phosphatase from entamoeba histolytica with a phosphotyrosine crude mimic hepes molecule in the active site

PDB Compounds: (A:) protein tyrosine phosphatase

SCOPe Domain Sequences for d3idoa1:

Sequence; same for both SEQRES and ATOM records:

>d3idoa1 c.44.1.0 (A:1-157) automated matches {Entamoeba histolytica [TaxId: 294381]}
mkllfvclgnicrspaaeavmkkviqnhhltekyicdsagtcsyhegqqadsrmrkvgks
rgyqvdsisrpvvssdfknfdyifamdndnyyelldrcpeqykqkifkmvdfcttiktte
vpdpyyggekgfhrvidiledacenliikleegklin

Timeline for d3idoa1:

• d3idoa1 first appeared in SCOPe 2.03, called d3idoa_
  
• d3idoa1 appears in SCOPe 2.07