Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (10 species) not a true protein |
Species Rhodococcus sp. [TaxId:51612] [232585] (1 PDB entry) |
Domain d3idaa2: 3ida A:352-575 [232586] Other proteins in same PDB: d3idaa1 automated match to d1ju3a1 complexed with cl, dbc, gol; mutant |
PDB Entry: 3ida (more details), 1.6 Å
SCOPe Domain Sequences for d3idaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3idaa2 b.18.1.0 (A:352-575) automated matches {Rhodococcus sp. [TaxId: 51612]} plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk ydrnsntggviareqleemctavnrihrgpehpshivlpiikrk
Timeline for d3idaa2: