SCOPe 2.03: Domain d3idaa2: 3ida A:352-575

Lineage for d3idaa2 (3ida A:352-575)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (10 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:51612] [232585] (1 PDB entry)

8. Domain d3idaa2: 3ida A:352-575 [232586]
   Other proteins in same PDB: d3idaa1
   automated match to d1ju3a1
   complexed with cl, dbc, gol; mutant

Details for d3idaa2

PDB Entry: 3ida, 1.6 Å

PDB Description: thermostable cocaine esterase with mutations l169k and g173q, bound to dtt adduct

PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d3idaa2:

Sequence; same for both SEQRES and ATOM records:

>d3idaa2 b.18.1.0 (A:352-575) automated matches {Rhodococcus sp. [TaxId: 51612]}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikrk

Timeline for d3idaa2:

• d3idaa2 is new in SCOPe 2.03-stable
  
• d3idaa2 appears in SCOPe 2.04
  
• d3idaa2 appears in the current release, SCOPe 2.08