Lineage for d3idaa2 (3ida A:352-574)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775385Species Rhodococcus sp. [TaxId:51612] [232585] (1 PDB entry)
  8. 2775386Domain d3idaa2: 3ida A:352-574 [232586]
    Other proteins in same PDB: d3idaa1, d3idaa3
    automated match to d1ju3a1
    complexed with cl, dbc, gol; mutant

Details for d3idaa2

PDB Entry: 3ida (more details), 1.6 Å

PDB Description: thermostable cocaine esterase with mutations l169k and g173q, bound to dtt adduct
PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d3idaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3idaa2 b.18.1.0 (A:352-574) automated matches {Rhodococcus sp. [TaxId: 51612]}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikr

SCOPe Domain Coordinates for d3idaa2:

Click to download the PDB-style file with coordinates for d3idaa2.
(The format of our PDB-style files is described here.)

Timeline for d3idaa2: