Lineage for d3idaa1 (3ida A:4-351)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1383512Family c.69.1.21: PepX catalytic domain-like [69581] (4 proteins)
  6. 1383561Protein automated matches [232528] (2 species)
    not a true protein
  7. 1383569Species Rhodococcus sp. [TaxId:51612] [232583] (1 PDB entry)
  8. 1383570Domain d3idaa1: 3ida A:4-351 [232584]
    Other proteins in same PDB: d3idaa2
    automated match to d1ju3a2
    complexed with cl, dbc, gol; mutant

Details for d3idaa1

PDB Entry: 3ida (more details), 1.6 Å

PDB Description: thermostable cocaine esterase with mutations l169k and g173q, bound to dtt adduct
PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d3idaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3idaa1 c.69.1.21 (A:4-351) automated matches {Rhodococcus sp. [TaxId: 51612]}
gnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwlefv
rdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylgvtq
wqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsakigtqlitsrsdarp
edaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsislfer
lgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfgiaa
typiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdw

SCOPe Domain Coordinates for d3idaa1:

Click to download the PDB-style file with coordinates for d3idaa1.
(The format of our PDB-style files is described here.)

Timeline for d3idaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3idaa2