Lineage for d3ibda1 (3ibd A:30-491)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (40 PDB entries)
  8. 2005450Domain d3ibda1: 3ibd A:30-491 [232582]
    Other proteins in same PDB: d3ibda2, d3ibda3
    automated match to d3g5nc_
    complexed with cm5, cpz, hem, scn

Details for d3ibda1

PDB Entry: 3ibd (more details), 2 Å

PDB Description: Crystal structure of a cytochrome P450 2B6 genetic variant in complex with the inhibitor 4-(4-chlorophenyl)imidazole
PDB Compounds: (A:) Cytochrome P450 2B6

SCOPe Domain Sequences for d3ibda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ibda1 a.104.1.1 (A:30-491) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairealv
dkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeriqee
aqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfsli
ssvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidtyl
lhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyreie
qvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdtevf
lilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelflf
fttilqnfsmaspvapedidltpqecgvgkipptyqirflpr

SCOPe Domain Coordinates for d3ibda1:

Click to download the PDB-style file with coordinates for d3ibda1.
(The format of our PDB-style files is described here.)

Timeline for d3ibda1: