![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein automated matches [190068] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189507] (94 PDB entries) |
![]() | Domain d3ibda1: 3ibd A:30-491 [232582] Other proteins in same PDB: d3ibda2, d3ibda3 automated match to d3g5nc_ complexed with cm5, cpz, hem, scn |
PDB Entry: 3ibd (more details), 2 Å
SCOPe Domain Sequences for d3ibda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ibda1 a.104.1.1 (A:30-491) automated matches {Human (Homo sapiens) [TaxId: 9606]} lppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairealv dkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeriqee aqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfsli ssvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidtyl lhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyreie qvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdtevf lilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelflf fttilqnfsmaspvapedidltpqecgvgkipptyqirflpr
Timeline for d3ibda1: