SCOPe 2.07: Domain d3iaxa2: 3iax A:162-430

Lineage for d3iaxa2 (3iax A:162-430)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.4: TolB, C-terminal domain [50960] (2 families)

5. Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins)

6. Protein automated matches [232579] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [232580] (2 PDB entries)

8. Domain d3iaxa2: 3iax A:162-430 [232581]
   Other proteins in same PDB: d3iaxa1
   automated match to d2hqsa1
   complexed with ca, gol, na

Details for d3iaxa2

PDB Entry: 3iax, 2.6 Å

PDB Description: The crystal structure of the TolB box of Colicin A in complex with TolB reveals important differences in the recruitment of the common TolB translocation portal used by group A colicins

PDB Compounds: (A:) protein tolb

SCOPe Domain Sequences for d3iaxa2:

Sequence; same for both SEQRES and ATOM records:

>d3iaxa2 b.68.4.1 (A:162-430) automated matches {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

Timeline for d3iaxa2:

• d3iaxa2 first appeared in SCOPe 2.03
  
• d3iaxa2 appears in SCOPe 2.06
  
• d3iaxa2 appears in the current release, SCOPe 2.08