Class b: All beta proteins [48724] (176 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.4: TolB, C-terminal domain [50960] (1 family) |
Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins) |
Protein automated matches [232579] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [232580] (2 PDB entries) |
Domain d3iaxa2: 3iax A:162-430 [232581] Other proteins in same PDB: d3iaxa1 automated match to d2hqsa1 complexed with ca, gol, na |
PDB Entry: 3iax (more details), 2.6 Å
SCOPe Domain Sequences for d3iaxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iaxa2 b.68.4.1 (A:162-430) automated matches {Escherichia coli [TaxId: 562]} afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl nlvstdgrfkarlpatdgqvkfpawspyl
Timeline for d3iaxa2: