Lineage for d3iaxa2 (3iax A:162-430)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808379Superfamily b.68.4: TolB, C-terminal domain [50960] (2 families) (S)
  5. 2808380Family b.68.4.1: TolB, C-terminal domain [50961] (2 proteins)
  6. 2808393Protein automated matches [232579] (3 species)
    not a true protein
  7. 2808394Species Escherichia coli [TaxId:562] [232580] (2 PDB entries)
  8. 2808399Domain d3iaxa2: 3iax A:162-430 [232581]
    Other proteins in same PDB: d3iaxa1
    automated match to d2hqsa1
    complexed with ca, gol, na

Details for d3iaxa2

PDB Entry: 3iax (more details), 2.6 Å

PDB Description: The crystal structure of the TolB box of Colicin A in complex with TolB reveals important differences in the recruitment of the common TolB translocation portal used by group A colicins
PDB Compounds: (A:) protein tolb

SCOPe Domain Sequences for d3iaxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaxa2 b.68.4.1 (A:162-430) automated matches {Escherichia coli [TaxId: 562]}
afrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtfes
grsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgqir
qvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadvss
dgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvl
nlvstdgrfkarlpatdgqvkfpawspyl

SCOPe Domain Coordinates for d3iaxa2:

Click to download the PDB-style file with coordinates for d3iaxa2.
(The format of our PDB-style files is described here.)

Timeline for d3iaxa2: