SCOPe 2.07: Domain d3iaxa1: 3iax A:32-161

Lineage for d3iaxa1 (3iax A:32-161)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families)

5. Family c.51.2.0: automated matches [232575] (1 protein)
   not a true family

6. Protein automated matches [232576] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [232577] (2 PDB entries)

8. Domain d3iaxa1: 3iax A:32-161 [232578]
   Other proteins in same PDB: d3iaxa2
   automated match to d2ivza2
   complexed with ca, gol, na

Details for d3iaxa1

PDB Entry: 3iax, 2.6 Å

PDB Description: The crystal structure of the TolB box of Colicin A in complex with TolB reveals important differences in the recruitment of the common TolB translocation portal used by group A colicins

PDB Compounds: (A:) protein tolb

SCOPe Domain Sequences for d3iaxa1:

Sequence; same for both SEQRES and ATOM records:

>d3iaxa1 c.51.2.0 (A:32-161) automated matches {Escherichia coli [TaxId: 562]}
dsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaaw
salgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasde
vfekltgikg

Timeline for d3iaxa1:

• d3iaxa1 first appeared in SCOPe 2.03
  
• d3iaxa1 appears in SCOPe 2.06
  
• d3iaxa1 appears in the current release, SCOPe 2.08