Lineage for d3iaxa1 (3iax A:32-161)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856157Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1856309Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) (S)
  5. 1856323Family c.51.2.0: automated matches [232575] (1 protein)
    not a true family
  6. 1856324Protein automated matches [232576] (2 species)
    not a true protein
  7. 1856325Species Escherichia coli [TaxId:562] [232577] (2 PDB entries)
  8. 1856330Domain d3iaxa1: 3iax A:32-161 [232578]
    Other proteins in same PDB: d3iaxa2
    automated match to d2ivza2
    complexed with ca, gol, na

Details for d3iaxa1

PDB Entry: 3iax (more details), 2.6 Å

PDB Description: The crystal structure of the TolB box of Colicin A in complex with TolB reveals important differences in the recruitment of the common TolB translocation portal used by group A colicins
PDB Compounds: (A:) protein tolb

SCOPe Domain Sequences for d3iaxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaxa1 c.51.2.0 (A:32-161) automated matches {Escherichia coli [TaxId: 562]}
dsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaaw
salgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasde
vfekltgikg

SCOPe Domain Coordinates for d3iaxa1:

Click to download the PDB-style file with coordinates for d3iaxa1.
(The format of our PDB-style files is described here.)

Timeline for d3iaxa1: