Lineage for d3i6tc1 (3i6t C:6-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948276Species Jannaschia sp. [TaxId:290400] [232554] (1 PDB entry)
  8. 2948279Domain d3i6tc1: 3i6t C:6-130 [232560]
    Other proteins in same PDB: d3i6ta2, d3i6ta3, d3i6tb2, d3i6tc2
    automated match to d2p8ba1
    complexed with k, mg

Details for d3i6tc1

PDB Entry: 3i6t (more details), 1.9 Å

PDB Description: crystal structure of muconate cycloisomerase from jannaschia sp.
PDB Compounds: (C:) Muconate cycloisomerase

SCOPe Domain Sequences for d3i6tc1:

Sequence, based on SEQRES records: (download)

>d3i6tc1 d.54.1.0 (C:6-130) automated matches {Jannaschia sp. [TaxId: 290400]}
qiiagftlwhlslpvtarrdhgigsvagavevvvlrlqadsgavgygeaspwvvftgsve
atyaaldrylrplvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvw
allgg

Sequence, based on observed residues (ATOM records): (download)

>d3i6tc1 d.54.1.0 (C:6-130) automated matches {Jannaschia sp. [TaxId: 290400]}
qiiagftlwhlslpvtavevvvlrlqadsgavgygeaspwvvftgsveatyaaldrylrp
lvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvwallgg

SCOPe Domain Coordinates for d3i6tc1:

Click to download the PDB-style file with coordinates for d3i6tc1.
(The format of our PDB-style files is described here.)

Timeline for d3i6tc1: