SCOPe 2.08: Domain d3i6tc1: 3i6t C:6-130

Lineage for d3i6tc1 (3i6t C:6-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Jannaschia sp. [TaxId:290400] [232554] (1 PDB entry)

8. Domain d3i6tc1: 3i6t C:6-130 [232560]
   Other proteins in same PDB: d3i6ta2, d3i6ta3, d3i6tb2, d3i6tc2
   automated match to d2p8ba1
   complexed with k, mg

Details for d3i6tc1

PDB Entry: 3i6t, 1.9 Å

PDB Description: crystal structure of muconate cycloisomerase from jannaschia sp.

PDB Compounds: (C:) Muconate cycloisomerase

SCOPe Domain Sequences for d3i6tc1:

Sequence, based on SEQRES records:

>d3i6tc1 d.54.1.0 (C:6-130) automated matches {Jannaschia sp. [TaxId: 290400]}
qiiagftlwhlslpvtarrdhgigsvagavevvvlrlqadsgavgygeaspwvvftgsve
atyaaldrylrplvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvw
allgg

Sequence, based on observed residues (ATOM records):

>d3i6tc1 d.54.1.0 (C:6-130) automated matches {Jannaschia sp. [TaxId: 290400]}
qiiagftlwhlslpvtavevvvlrlqadsgavgygeaspwvvftgsveatyaaldrylrp
lvlgravgdhaaimedaraavahcteakaaldtalydlrariagvpvwallgg

Timeline for d3i6tc1:

• d3i6tc1 first appeared in SCOPe 2.03
  
• d3i6tc1 appears in SCOPe 2.07