SCOPe 2.08: Domain d3i6bb_: 3i6b B:

Lineage for d3i6bb_ (3i6b B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225534] (4 PDB entries)

8. Domain d3i6bb_: 3i6b B: [232553]
   automated match to d2r8xh_
   complexed with kdo, mg, po4

Details for d3i6bb_

PDB Entry: 3i6b, 2.49 Å

PDB Description: crystal structure of yrbi lacking the last 8 residues, in complex with kdo and inorganic phosphate

PDB Compounds: (B:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d3i6bb_:

Sequence; same for both SEQRES and ATOM records:

>d3i6bb_ c.108.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
aslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygirca
ltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgd
dlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl

Timeline for d3i6bb_:

• d3i6bb_ first appeared in SCOPe 2.03
  
• d3i6bb_ appears in SCOPe 2.07