Lineage for d1d0jc1 (1d0j C:350-501)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045537Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045538Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2045539Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2045555Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 2045556Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. 2045598Domain d1d0jc1: 1d0j C:350-501 [23255]
    Other proteins in same PDB: d1d0ja2, d1d0jb2, d1d0jc2, d1d0jd2, d1d0je2, d1d0jf2

Details for d1d0jc1

PDB Entry: 1d0j (more details), 2.5 Å

PDB Description: structure of tnf receptor associated factor 2 in complex with a m4-1bb peptide
PDB Compounds: (C:) tumor necrosis factor receptor associated protein 2

SCOPe Domain Sequences for d1d0jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0jc1 b.8.1.1 (C:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOPe Domain Coordinates for d1d0jc1:

Click to download the PDB-style file with coordinates for d1d0jc1.
(The format of our PDB-style files is described here.)

Timeline for d1d0jc1: