SCOPe 2.03: Domain d3i54b1: 3i54 B:-6-144

Lineage for d3i54b1 (3i54 B:-6-144)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (8 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [231918] (2 PDB entries)

8. Domain d3i54b1: 3i54 B:-6-144 [232548]
   Other proteins in same PDB: d3i54b2
   automated match to d3r6sf1
   protein/DNA complex; complexed with cmp

Details for d3i54b1

PDB Entry: 3i54, 2.2 Å

PDB Description: crystal structure of mtbcrp in complex with camp

PDB Compounds: (B:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d3i54b1:

Sequence, based on SEQRES records:

>d3i54b1 b.82.3.0 (B:-6-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
nlyfqshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisg
kvkigrrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswi
adrpeiseqllrvlarrlrrtnnnladlift

Sequence, based on observed residues (ATOM records):

>d3i54b1 b.82.3.0 (B:-6-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
nlyfqshmdeilaragifqepsaiaallqpvdfprghtvfaegepgdrlyiiisgkvkig
rrnlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeiseqll
rvlarrlrrtnnnladlift

Timeline for d3i54b1:

• d3i54b1 is new in SCOPe 2.03-stable
  
• d3i54b1 appears in SCOPe 2.04
  
• d3i54b1 appears in the current release, SCOPe 2.08