Lineage for d3i3rb1 (3i3r B:5-187)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2154171Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2154172Protein automated matches [190777] (21 species)
    not a true protein
  7. 2154259Species Babesia bovis [TaxId:484906] [232542] (3 PDB entries)
  8. 2154265Domain d3i3rb1: 3i3r B:5-187 [232546]
    Other proteins in same PDB: d3i3ra2, d3i3rb2
    automated match to d2oipa1
    complexed with cl

Details for d3i3rb1

PDB Entry: 3i3r (more details), 2.35 Å

PDB Description: x-ray structure dihydrofolate reductase/thymidylate synthase from babesia bovis at 2.35a resolution
PDB Compounds: (B:) Dihydrofolate reductase/thymidylate synthase

SCOPe Domain Sequences for d3i3rb1:

Sequence, based on SEQRES records: (download)

>d3i3rb1 c.71.1.0 (B:5-187) automated matches {Babesia bovis [TaxId: 484906]}
yegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvvi
fgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifilg
gsflykevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfviy
erk

Sequence, based on observed residues (ATOM records): (download)

>d3i3rb1 c.71.1.0 (B:5-187) automated matches {Babesia bovis [TaxId: 484906]}
yegcgdltifvavalnkvighknqipwphithdfrflrngttyipppdiqnvvifgrkty
elknrinvilsrtvkevpgclvyedlstairdlranvphnkifilggsflykevldnglc
dkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfviyerk

SCOPe Domain Coordinates for d3i3rb1:

Click to download the PDB-style file with coordinates for d3i3rb1.
(The format of our PDB-style files is described here.)

Timeline for d3i3rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3i3rb2